PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10011992m
Common NameCICLE_v10011992mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family G2-like
Protein Properties Length: 372aa    MW: 42161 Da    PI: 8.8073
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10011992mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.23.3e-3266119255
          G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                      prlrWtp+LH rFv+ave+LGG+e+AtPk +l++m++kgL+++hvkSHLQ+YR+
  Ciclev10011992m  66 PRLRWTPDLHLRFVHAVEKLGGQERATPKLVLQMMDIKGLSIAHVKSHLQMYRS 119
                      8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.8462122IPR017930Myb domain
Gene3DG3DSA:1.10.10.606.8E-3062120IPR009057Homeodomain-like
SuperFamilySSF466891.76E-1464120IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-2266121IPR006447Myb domain, plants
PfamPF002491.6E-967118IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MEGSEGTECS KTCPSASDEI PDDEGESEEN DDESSKPKNG GSSSNSTVEE NDKKPPVRPY  60
VRSKMPRLRW TPDLHLRFVH AVEKLGGQER ATPKLVLQMM DIKGLSIAHV KSHLQMYRSK  120
KIDDPGRAMA DHRHLVESGD RNIYNLSQLP MLQGYNNQSQ ASGFRYGEAS WSTAREYLMR  180
NPYVSRSLID ETRSRLYGTV AEKIFDGTNC NWPSNNNFRM STTSSALSYG ANSTWKMPEL  240
KEEIQTSFNR NRHPWQAQSR LRPIELNPVR QQHTKIEEQK SATMKRKATD CGKLDLELSL  300
RLRPSSNEEE SRPPRQGSLE EKINKVDGEL SLSLYSPSSS SSKHRRLMKE GEDHSNKERA  360
TKRASTLDLT I*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00297DAPTransfer from AT2G38300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006429461.10.0hypothetical protein CICLE_v10011992mg
RefseqXP_006481085.10.0PREDICTED: putative Myb family transcription factor At1g14600
TrEMBLV4SZQ40.0V4SZQ4_9R
STRINGPOPTR_0016s12940.11e-108(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM36328184
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-65G2-like family protein